DPCstruct | MC59965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 130 |
|---|---|
| Mean domain length (aa) | 131 ± 18 aa |
| Standard deviation of domain lengths | 18.25 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X4ESV0 | 17-127 | SFRRFQYDAYCRVNELFARKLVPLLEPDDIIWVHDYHLIPLATELRRAGVTNPIGFFLHVPFPSFDALRALPPYEHLLRSMSSYDVI… |
| A0A377K4Y7 | 2-121 | PFLWPAFHYRLDLVQFQRPAWDGYLRVNALLADKLLPLLQDDDIIWIHDYHLLPFAHELRKRGVNNRIGFFLHIPFPTPEIFNALPT… |
| K3WI95 | 49-164 | None |
| A0A0S7DYA8 | 82-220 | None |
| A0A1V9YNQ3 | 332-486 | None |
| A0A6V7WJS0 | 142-260 | None |
| F2SZR3 | 139-275 | None |
| A0A6G1I272 | 268-403 | None |
| A0A151I569 | 150-290 | None |
| I2H1C3 | 283-419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.