DPCstruct | MC59960
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 312 ± 23 aa |
| Standard deviation of domain lengths | 23.34 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0U5GGQ2 | 21-345 | NPFNISKEVKIADFRGEFEVTYATFFELGPSQIGFEGEVQVADFRARAGLGYSHYPDNQLLIAKFSKVDLLEIIRVAGQVADIQPLK… |
| A0A7Y2HGE2 | 2-274 | DPMGIKGLSVADLGIQMGASFTTAPVLLPNIALAGKIDIGKFSGEAVVAFDTRNPSKSMIAASYNKIMLWDLINITTSKKLQQKIPK… |
| A0A0G4J5S4 | 97-422 | None |
| A0A2D0HLD9 | 222-524 | None |
| A0A3M2SLK7 | 10-335 | None |
| M5C899 | 86-372 | None |
| A0A067MCR3 | 88-431 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.