DPCstruct | MC59957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1117 |
|---|---|
| Mean domain length (aa) | 333 ± 100 aa |
| Standard deviation of domain lengths | 100.07 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 82.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 12.49 |
| Pfam Score | 86.68 |
| Assigned Pfam label(s) | PF10271- CL0431- CL0531- CL0063- CL0378 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A553N490 | 167-382 | DLDVRVLNFSHFGRKLPKSHKLGPDAFIQMALQLAYFRMYQTCCPTYESASLRMFKLGRTEAIRSTTIESFQFTQAMDDPSKNVPNS… |
| A0A7W1G0Z1 | 29-351 | AALLNKKMSAEKAPLFSFDIIHKTNGNSILVFSWNHLLMDSYGAALYLKQLNGYGQNNSFISEEIKIEFDLKSIRAAATAKSFLTES… |
| A0A6A6L048 | 2-221 | None |
| A0A6A6KV48 | 166-551 | None |
| A0A5S9XGY8 | 12-193 | None |
| A0A4V1ULR2 | 170-375 | None |
| A0A6P8CAE1 | 4-248 | None |
| A0A2N2QYH7 | 25-431 | None |
| A0A194ULN6 | 15-454 | None |
| L5K7L9 | 802-1163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.