DPCstruct | MC59952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 152 ± 15 aa |
| Standard deviation of domain lengths | 14.93 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7KSP3 | 2-145 | RHFEVAKMLKDLPRDASFLLRVVEPIKSGFANIGKPGQGKAKGGAISNGKATLRLNSKGPASVEVPDDVVDVAIEKINARLESYLGI… |
| A0A654H0R0 | 176-333 | AHSIAPGDMIECINGRAFSQCRHLDVMYYLKALPVGSDIVLRLISPEKSLLPGISKRQKQSSGIFGRQTIRITATKAEIIAALNEEQ… |
| A0A151NBE4 | 518-678 | None |
| A0A384DRD8 | 75-225 | None |
| A0A0N5DAB8 | 229-388 | None |
| A0A044RRL6 | 324-462 | None |
| H2LRQ4 | 176-333 | None |
| E4WVA3 | 148-286 | None |
| A0A1I7XJB8 | 1-115 | None |
| A0A6A0HED9 | 209-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.