DPCstruct | MC59946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 121 ± 11 aa |
| Standard deviation of domain lengths | 10.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7KL50 | 3-111 | INDLIEKLALSEKWHARQIYVQGCHRILKDHSIKSDQFSKELLPSIITLSIDKTPNVRISVAKLLSQELLHSDYFTGSQNPHHDDLM… |
| Q7QIA5 | 224-329 | FEFFNKHFASYSNWRRRQTYVIAAGKMLETDRVEVKIFRKHVFNNVLKLADDAVPNVRIQVAKCLKEIIAPHPNFANDPQVEPTLQK… |
| A0A4U5U8J1 | 553-681 | None |
| A0A820CAE6 | 66-195 | None |
| A0A5B7DT97 | 694-809 | None |
| A0A7R8X8S0 | 985-1097 | None |
| A0A833R9C4 | 537-669 | None |
| Q171I6 | 170-298 | None |
| A0A7M5XMC7 | 443-562 | None |
| A0A2D4P867 | 12-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.