DPCstruct | MC5994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 99 ± 7 aa |
| Standard deviation of domain lengths | 6.82 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W1Z2K3 | 1-97 | MSDTPPYAGLRSVLMSALEQAANGKGSDRHGNGLPFTDQPMMEIGRMTGAGGPAFQAMKKSQEALGMIRRGQDKAAEAELLGAINYL… |
| A0A6M3MGN4 | 61-158 | SLDLPQYNDVPGYERLRDVLERAMKQASRDKGAERHANDKPFHEQPMQVIADEHGEGFILGQARKKVLEAQQMVYRCENDKAVHELL… |
| A0A6M3IKP9 | 19-113 | None |
| A0A2W5RWV5 | 143-239 | None |
| I3TGL2 | 3-80 | None |
| A0A380WD09 | 95-201 | None |
| A0A158EAX3 | 88-189 | None |
| A0A3N5IXC1 | 1-100 | None |
| K2J751 | 20-112 | None |
| A0A084Y2E7 | 21-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.