DPCstruct | MC59930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 113 ± 18 aa |
| Standard deviation of domain lengths | 17.77 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A147KJ96 | 6-123 | GEPGTPASPARSSSPSRGLPAAADGTDLAACADAVCEVEVAEGDEFPVSGPHGLERIVVERVAPGEVTVTGYGDGGGSMVSGTTGAP… |
| H0KAI0 | 322-414 | PEPPRLPTADDGTNVAACADGACRIEVSEPVDLTVDGTRFTAAVSDGTVWITTDGSLIRIGGQGIAQFGHPGGTAVFTVVASDATTA… |
| A0A1S1PEY6 | 1-112 | None |
| A0A344LIH7 | 185-292 | None |
| A0A1S2Q565 | 7-93 | None |
| A0A5S4G7L8 | 302-397 | None |
| U5W3V5 | 18-134 | None |
| A0A7H8JUD0 | 55-193 | None |
| A0A7W7VHZ7 | 18-116 | None |
| A0A5D0NVE4 | 151-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.