DPCstruct | MC59929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 85 ± 2 aa |
| Standard deviation of domain lengths | 2.37 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 75.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 65.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2T5H0 | 175-262 | NEPSKTFNLRNYLLLLARLFDQEAICYCKNAIHDKENTYRVELVSALSGGFNEVWAEFADVTFSGPSQLPQSLTRLKNKAAAFFSKQP |
| J0RYX1 | 22-105 | FVFQNEPSDTFNLKKTLLVLARAFSQAAICYCQNASANEVDLIRAEPGSYGEVWDTFNGIAFSAPAQLPQFLTRLKDKVYTFFK |
| T0E447 | 79-158 | None |
| A0A2T6UCW5 | 46-129 | None |
| A0A1A9H452 | 181-268 | None |
| M3RWA2 | 1-86 | None |
| I9ZP31 | 67-155 | None |
| M3S9S1 | 67-152 | None |
| I9VUX1 | 100-183 | None |
| M3R485 | 117-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.