DPCstruct | MC59928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 188 |
|---|---|
| Mean domain length (aa) | 232 ± 41 aa |
| Standard deviation of domain lengths | 40.87 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 15.59 |
| Pfam Score | 93.93 |
| Assigned Pfam label(s) | PF05406- PF09234- PF04194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A7EFK8 | 5-237 | FKDEIHRLKKASLHFDLVPLDEDETPKLDTYFGGKPYVTDEIEIHECKNCKKNMEFICQFMMPVKNTENKKLYSFYYCFDCVKERGE… |
| A0A7W9RWH5 | 22-226 | PAPGEHTIALMMVDRSVTSDASDETRFGGLPAVNDGFRWPGCRSCGGAMQFQGQIRAPGAPHLHLLFMCANHPGECDEFLADGGGNA… |
| A0A6J4SI43 | 109-326 | None |
| A0A7S9YIP3 | 30-218 | None |
| A0A447TYH1 | 51-255 | None |
| A0A355Z542 | 92-390 | None |
| B8IHS4 | 3-158 | None |
| A0A1M5BWY2 | 156-349 | None |
| A0A7Y4ZGH0 | 261-454 | None |
| A0A519NEU1 | 198-391 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.