DPCstruct | MC59922
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 127 ± 15 aa |
| Standard deviation of domain lengths | 15.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11294 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P0WWI8 | 1-122 | MLYFLQILLENCLGWFLMKYKIQSADGNWGTYKNHLITTTDYQKFEDMLKMTLDGNSQQREQLTRYLEHNYQKGKLVYGLQVADGAL… |
| A0A4Q2UBC9 | 252-390 | GLDIEARLHRGLGRSLAESRFRTALRALVNTFFLRTGRTVGDFVPDAYRRQLVENSDFRKFDDGLLMTLDCSVDTADAIAARLADAE… |
| G8AFQ9 | 73-191 | None |
| A0A7S1UMT2 | 268-390 | None |
| A0A7S1UVX3 | 78-212 | None |
| M6KAZ8 | 166-316 | None |
| A0A1Y2K0C4 | 234-350 | None |
| A0A1G2VTY7 | 50-169 | None |
| A0A7J4VD58 | 199-324 | None |
| A0A090X3H6 | 124-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.