DPCstruct | MC5992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 102 ± 10 aa |
| Standard deviation of domain lengths | 10.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M3MD63 | 1-114 | MIPDSFKQVMEEGECCVCGGPLKGSHINFVNLDKMVTWPFPAWGNILVDEPWQRAVAILCDNCVDEEKGVIKGEVKRALEIRDGAPV… |
| A0A367RG02 | 39-137 | PDYDEEPLDLGACCGCGTTNNSLVRNILTLHKKALVAGTGWECFICGIPANGAIAVVCDDCLAQLEEGKEVLKQAVYGDVLDKQRCD… |
| A0A7X3VR09 | 3-91 | None |
| A0A496SW76 | 1-92 | None |
| A0A3S0FSL0 | 1-95 | None |
| A0A6M3MIA0 | 65-162 | None |
| A0A6M3MDV7 | 1-102 | None |
| A0A2C6WCZ2 | 4-105 | None |
| A0A6M3MFW6 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.