DPCstruct | MC5990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 59 ± 4 aa |
| Standard deviation of domain lengths | 4.49 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 59.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D9DRG2 | 18-72 | DSAAISAIEFALDADEGMVFLRCWIQGDFDVIRKEWPEAPEAVFIGADPFYKPAQ |
| A0A6M3M7R0 | 97-165 | DLTAPPPAEDDWQDIDPAAAAIGFALQTEAPMEFLRLWNEGSFDDIRREWPDAPDDVFIGADPLFQPAA |
| A0A161ZF38 | 50-106 | None |
| A0A1Q9XNW4 | 180-239 | None |
| A0A161Z9R8 | 101-158 | None |
| A0A5C7NEI3 | 2-57 | None |
| A0A2S0PEE3 | 46-104 | None |
| F9S2W1 | 1-57 | None |
| A0A6H1ZHD5 | 2-57 | None |
| A0A3N8XTW5 | 112-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.