DPCstruct | MC599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 94 ± 12 aa |
| Standard deviation of domain lengths | 12.44 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 31.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14333 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S9CY25 | 5-89 | EHFQNGETWKRGAYMLLFAVIYAVAELVAWGVALFQFGSKLVTGDINPRLVDFGQRLSTYIYQLLVYVTFKSDDKPYPFSDWPAA |
| A0A545SRZ1 | 3-102 | DKLKSNITSSKHWLRFLFMLLFALLLQVATAIMWVLVILQFLFALITGKDNAKLRAFGSSLCIYIYESLQFLTYNREDKPFPFADWP… |
| A0A3B8S844 | 68-158 | None |
| A0A2G6CI93 | 51-138 | None |
| A0A5Q4GDN0 | 2-108 | None |
| A0A109Q555 | 2-80 | None |
| A0A2E1CVB3 | 13-102 | None |
| A0A061QBK5 | 139-247 | None |
| A0A351T2G2 | 17-111 | None |
| A0A2G2QA67 | 31-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.