DPCstruct | MC59896
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4986 |
|---|---|
| Mean domain length (aa) | 194 ± 33 aa |
| Standard deviation of domain lengths | 33.34 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 13.33 |
| Pfam Score | 88.23 |
| Assigned Pfam label(s) | PF05731- CL0692- PF11957- CL0616- PF10221 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I3DTY7 | 9-203 | VSGTANIAILLDASGSMAQKIGGKTKMDLAKEAVNQFVSSMPEGSNVSLRVYGHKGSNSDNDKKLSCGSTEMVYDLKPYNAADFKAS… |
| U9UKY4 | 2-118 | EVDLCFVMDCTSSMGSHIEGAKSSIKKIVDYMANMKPAIVVRVGFCGYRDHCDGSNRLQIIEFTTSCNEFKNNVSNVSALGGGDAPE… |
| A0A806K218 | 28-185 | None |
| A0A1Y1NBH0 | 75-278 | None |
| A0A7R9L5J6 | 7-227 | None |
| A0A7R9KV68 | 14-228 | None |
| A0A7R9KDJ1 | 1023-1213 | None |
| A0A5S6QQJ4 | 327-516 | None |
| R6Z992 | 793-987 | None |
| A0A3C0GD64 | 166-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.