DPCstruct | MC59895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 152 ± 39 aa |
| Standard deviation of domain lengths | 39.16 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 86.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19935 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C1QXS3 | 14-146 | EYRERFVEVVALIDQFCDRHLNDEYKAVGRKLAAMMCQKGSPILRGKVASWACGLMYAVGRVNFLTDPDQTPHMTAEQIAAGFGVSQ… |
| A0A854IFY6 | 35-169 | PDEPFRWDRIPDDVRARVHDVLALTDGCCEKLLDLEYRTACRRVLARIAVRGPEVFRRKGRAETAAAGLVWMVGKANDLFAQHTGGM… |
| A0A399YJV5 | 4-202 | None |
| A0A843FAZ0 | 356-485 | None |
| A0A1F6ZU54 | 3-160 | None |
| A0A1R4HZ44 | 296-500 | None |
| A0A2G9NPI8 | 4-140 | None |
| A0A7Z9Y2Y9 | 88-203 | None |
| A0A166DCT7 | 4-127 | None |
| A0A849HHZ1 | 67-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.