DPCstruct | MC59892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 310 ± 57 aa |
| Standard deviation of domain lengths | 57.10 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485KXL1 | 4-287 | WTENSNLVARFRELYELNASKATVNVPATPPLDVTSRLTTFGLAWADLHPFAQQAVLWDMGLVAQDNSSRINQVLTVCGSDNKTGIG… |
| A0A6A3KAW4 | 38-255 | NDSFVFDGTNSDIAQQLYIRHQAGDIADALELNSIPASVTERLDPLRISFDDLPGLVQRALIWDSGFAISPDNDPVQIWTMENYTMA… |
| A0A6A4D0N3 | 36-301 | None |
| A0A662XG83 | 17-379 | None |
| A0A5D6XPP5 | 2-294 | None |
| A0A5D6XXY6 | 402-756 | None |
| A0A5D6YAY2 | 20-390 | None |
| A0A6A3UPP7 | 114-432 | None |
| K3WJA3 | 7-378 | None |
| K3WN80 | 38-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.