DPCstruct | MC5989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 121 ± 11 aa |
| Standard deviation of domain lengths | 10.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J0AYY8 | 24-152 | EHHLNQEDVDMANGLVAHIERTRCSRQPKIGDRVVYTSIYGDWYGNAVIEKFEDGECSLCLSPYVPFIWKSPLGIGCSVSGGPFTSV… |
| A0A6M3M2G8 | 19-146 | PESTGRHILDTIAVVEEHLNGGIELTKPMPGDLVMILNSGDCLVKNRSLGIIEGIVGEYRNHYLVCFNDSTFNDGKIVNASGGPAYC… |
| A0A7W3VUP2 | 60-191 | None |
| A0A523D6P5 | 15-151 | None |
| A0A2S0N6A5 | 9-120 | None |
| A0A523TC42 | 2-107 | None |
| A0A218PUL2 | 15-139 | None |
| A0A5N7MPM5 | 81-195 | None |
| A0A543K3Z6 | 4-124 | None |
| A0A2A7EIL5 | 17-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.