DPCstruct | MC59878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 158 ± 14 aa |
| Standard deviation of domain lengths | 14.34 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485KAE5 | 2-163 | GYIPGRVNADMRLTPPLVLANASGMTMLTMYRFAARAFCTGCTPVVELGLDTCTIAYSFNDTTKLLDIESSHAIYGQTHALGILFER… |
| A0A1V9ZAG3 | 210-367 | RLTSAFAVANTTTTAPTSVNVSLYRIYSKSFCSACVPIAELGLLTCTLDYTYNATSRKLVVSSSRGIRGSVHEVGVLLQKGGFVSAA… |
| A0A1V9YS27 | 1-189 | None |
| A0A485KIF6 | 241-405 | None |
| A0A1W0ACL8 | 464-611 | None |
| A0A3R6Y8V7 | 438-593 | None |
| A0A397FD36 | 622-784 | None |
| A0A6G0WMS2 | 23-171 | None |
| A0A6G0WMW3 | 1-160 | None |
| W4FW16 | 188-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.