DPCstruct | MC59871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 138 ± 25 aa |
| Standard deviation of domain lengths | 25.46 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 66.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03735 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9SR03 | 1-137 | MRSSGVARAKGRPSGNGKPSSSFHIEQQIRQLELDAYLSLLRAFSAQSEVITWSKEGLMSDMRKELRVADEQHREMLGKVGQDETLQ… |
| A0A4D8ZL85 | 3-108 | QMDMEYEIHNLEQIAYDVVLRAFKAQSDALTWEKEGLITELRKELRVSDDEHRELLSQVNGDDLIRRIREWREAGGNRNIAPSAQHI… |
| A0A2Z7D9H6 | 2-155 | None |
| A0A2P2KUV7 | 1-148 | None |
| A0A7J6FXL7 | 81-235 | None |
| A0A804P0G7 | 26-167 | None |
| A0A4S4D218 | 23-174 | None |
| A0A445JEW6 | 2-104 | None |
| A0A7S4PFI8 | 1-177 | None |
| A0A2G5EE78 | 1-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.