DPCstruct | MC59870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 91 ± 6 aa |
| Standard deviation of domain lengths | 6.11 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 73.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9SNI3 | 3-89 | QLRMEYLREGAHSQVMESGHIIICGANNHITTVLKQLNRAHEFAIRDGTAASRKQTVLLLSERARRETERLVSPVTKECTQINILTR |
| A0A7J0EF53 | 34-127 | MTEQFRNNMQKLREGAQTQVLETDHIIICGVNSHLAFILMQLNKYHEFSVCLGTATARKQRILLLSDLPRKQIDNLAGSIAKDLNYI… |
| A0A7J0GD88 | 3-75 | None |
| A0A452Y7X7 | 162-255 | None |
| Q56XW5 | 1-99 | None |
| A0A287F242 | 162-255 | None |
| A0A452Y7X2 | 1-94 | None |
| A0A5N5LQP6 | 406-493 | None |
| A0A438F7B4 | 245-336 | None |
| A0A061ELZ8 | 257-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.