DPCstruct | MC59864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 6.49 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I3REW7 | 4-79 | YSLQKYKGTATRHTCPKCGDRHSFVYYVDENNVPLHPSVGRCNHESGCGYHYTPKEYFHEHPEHRTTNDFSFDRQR |
| C9KUP7 | 3-69 | THRFILEPYKGVSTRHTCPNCHRQRCFSKYIDTEKQIKFPEYVGRCDHEQKCGYHFTPRDYFEQNPS |
| A0A2W2B3S2 | 2-69 | None |
| A0A7K1SHH8 | 1-79 | None |
| A0A5C8LG21 | 3-67 | None |
| A0A6A7WBF3 | 169-234 | None |
| A0A5J4RCG5 | 6-87 | None |
| A0A1S9PDV7 | 1-66 | None |
| A0A512BHV1 | 7-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.