DPCstruct | MC59857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 290 ± 58 aa |
| Standard deviation of domain lengths | 57.59 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 34.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833UT06 | 21-313 | AVKEVTTRLNEKFEDKLGSTIGGTVASYFENVLKNQPSPDDNYLKQMSRVRTEKDLDVLYREIFDYMAKHYHVSALTGAAKFVGQDI… |
| A0A376KZH8 | 3-260 | ASVKDRDAWAKDLATTFESQGLAPTLENVCSVLAVAQQESNYQADPAVPGLSKIAWQEIDRRAERMHIPAFLVHTALKIKSPNGKSY… |
| A0A2X3FJJ9 | 10-322 | None |
| C8C102 | 1-185 | None |
| A0A377AZ54 | 391-708 | None |
| A0A7H4ME98 | 6-198 | None |
| A0A345ZPD3 | 10-322 | None |
| A0A6N6X9Z4 | 1-222 | None |
| A0A0G0MZ18 | 715-1079 | None |
| A0A4U9HJX3 | 1-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.