DPCstruct | MC59853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 94 ± 9 aa |
| Standard deviation of domain lengths | 9.15 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 35.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833PGT3 | 13-106 | HQLSELIQAEWEALCDGCGLCCLVKLEDDESHEIAYTKVSCKLLDCKTAQCSDYPNRLNYVPDCIQLSPEKLAQIHWLPSSCAYRRV… |
| A0A2D6CLX8 | 53-150 | RIERWLKRNLPPQGSPEWEALCTECGKCCYDKVWRGSRLMLLKSACGYLDTKTNLCKCYEDRFDNEPLCLPVGAEIMQMGGLPEDCP… |
| A0A5C1Q8B4 | 6-86 | None |
| A0A0F9IN59 | 58-169 | None |
| A0A7C4EHN5 | 17-110 | None |
| E9TJ12 | 51-142 | None |
| A0A0F9L3V4 | 4-91 | None |
| D7DQG3 | 21-109 | None |
| A0A832SWH5 | 6-96 | None |
| A0A7V3KE63 | 20-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.