DPCstruct | MC5984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 107 ± 9 aa |
| Standard deviation of domain lengths | 9.34 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M3LP67 | 23-124 | PLEYESIEEWRAEARELFGDDGMKWRFVCPSCGYVASIQDWKDAGASSGEAAFSCIGRHLDKCHDAFQKGQGPCNYAGGGLFRINPI… |
| A0A5J4RVW2 | 95-190 | SNVKILLIEDWLKQLKERYGNNPEDWKFKCPSCGNVQSGKDFIENGITDFNNKIYYNCIGRYVKGKGCDWSLGGFLQIHKTVIVKDM… |
| A0A7Y5U9D3 | 1-110 | None |
| A0A3D0HY62 | 112-208 | None |
| A0A1B2HC61 | 94-213 | None |
| A0A4U2XGC8 | 1-106 | None |
| A0A0C1WYL5 | 1-119 | None |
| Q0RM33 | 1-103 | None |
| A0A842ZN68 | 8-125 | None |
| A0A0F9PIP6 | 72-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.