DPCstruct | MC59839
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 197 ± 27 aa |
| Standard deviation of domain lengths | 26.85 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.68 |
| Pfam Score | 91.61 |
| Assigned Pfam label(s) | PF02810- PF03695- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E6WT42 | 5-180 | LTEKELDRLEDLLIKYGNDLSVLNIAELHGFFTALASSVPQVTPERWLPVASGGKVPKFKTPSDEEAYTALMLRFASDVASELANGL… |
| A0A126S148 | 349-535 | YPGHPPMLPALSEKELDRLEDLLITYGNDYSVLNLAELNGFFTALASSPKKVNPEQWLPSVAGGKVPKFKKPAHEEAYTALMLRYAS… |
| A0A6N0ZBF3 | 89-296 | None |
| A0A661F156 | 13-205 | None |
| A0A545SB48 | 1-197 | None |
| A0A3M0FTK1 | 1-195 | None |
| A0A1G7CIN3 | 782-1009 | None |
| A0A3D0ZYG3 | 3-169 | None |
| A0A7W4FLD3 | 2-205 | None |
| A0A3M0A5A8 | 8-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.