DPCstruct | MC59827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 155 ± 23 aa |
| Standard deviation of domain lengths | 22.73 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 12.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F4JKB0 | 1-114 | FLDLLQDAGFQPVADLDKTPDQLPGWSVLVAMGKLHAILQPAAAGGSTGWWQAHQPLQVTDAWRFAANQLGEVTMYAVPAGTVGRQP… |
| A0A7C7DIU3 | 4-144 | AQIIVGCMKDAGTNVPVVALSLATPQEAQEVASIILRCQNGSKPFSLGPAVYVGDTQIRVTVLEANPYYVEIDARKDPRHLTSAYYV… |
| A0A367UFB9 | 9-131 | None |
| A0A7V8VAX5 | 16-225 | None |
| A0A2G4E8V8 | 124-288 | None |
| A0A7T8BBM9 | 531-703 | None |
| A0A221W4N5 | 113-263 | None |
| A0A1I5X4Y2 | 1-143 | None |
| A0A1H7MSQ8 | 7-145 | None |
| W2CGD7 | 378-557 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.