DPCstruct | MC59820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 234 ± 31 aa |
| Standard deviation of domain lengths | 31.39 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 39.82 |
| Pfam Score | 95.28 |
| Assigned Pfam label(s) | PF14288- PF04652 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453F7L0 | 3-215 | SQWRADQDLMDWLGAFFGFQRDNVRNQREHLVLLLANAQMRLSSADFSDTLEPRIARSLRRKLLRNYTSWCGFLGRRPNVYVPDADP… |
| A0A0K9PAE5 | 106-338 | LPEVKAAMSSLKYIRGLPELPSDFSVPTTRNVDILDFLHFVFGFQESNVSNQREHIVLLLANEQSRFFTPVGDDPKLDEDASRNVFE… |
| A0A287PW09 | 1-212 | None |
| A0A287Y0V3 | 2-216 | None |
| A0A835HAG8 | 136-282 | None |
| A0A453DGY4 | 39-286 | None |
| A0A287PYJ5 | 232-443 | None |
| A0A5D3BGT4 | 189-438 | None |
| A0A287RHA0 | 41-268 | None |
| A0A453Q8Q3 | 108-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.