DPCstruct | MC5982
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 96 ± 13 aa |
| Standard deviation of domain lengths | 13.24 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812W173 | 167-262 | WVSFPEYGSRVVLWQQFMEEHGVTVDPGKLNISTLARVSEGYPAGSIKQTVDRVLTARRVQQLKNRPLKVQEFIGPLSRTAFCWKEE… |
| L5M4J3 | 40-135 | HSLTLILWQQIIQRHGGVITSALNISCLAKVTDGFTQGHIVRVVRSVLTDRRLRQQQQKPLIAMEFMGALSTMDPIYQEEEDSFKNW… |
| A0A1S8XAY9 | 3-106 | None |
| D8RSC0 | 424-500 | None |
| G3IFH3 | 3-82 | None |
| A0A091DJZ8 | 853-954 | None |
| E4XXW9 | 6-102 | None |
| A0A6T8EDI8 | 60-160 | None |
| A0A817JFA8 | 86-182 | None |
| A0A151NTJ5 | 4-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.