DPCstruct | MC59814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 59 ± 7 aa |
| Standard deviation of domain lengths | 7.49 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 68.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0680 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0MUY6 | 7-55 | APASAGPRYAPEDPTLPKPWKGLIDGSSGVLYYWNPETNITQYERPSPP |
| A0A453EV33 | 1-53 | MSGTAAPRYAPDDPTVPKPWRGLVDGTTGYLYYWNPDTNVTQYEKPVPPEAQL |
| A0A445D421 | 16-68 | None |
| A0A4D9BIX3 | 2-46 | None |
| A0A1D6F8D2 | 1-62 | None |
| A0A6I9RCL6 | 6-58 | None |
| A0A484KJG2 | 2-57 | None |
| A0A2N9J732 | 14-84 | None |
| A0A2N9EIZ8 | 1-69 | None |
| A0A2P2K945 | 1-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.