DPCstruct | MC59812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Standard deviation of domain lengths | 12.37 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453EUI8 | 13-112 | QEGGNIVDMALAIADIKFTYVVSCQVYGMQKVSKNLKDKACYLNILNLMIMYPSLRIAYIDEVEAPTKNGTTEKTYYSVLVKGVGEK… |
| A0A287LLT7 | 1-77 | MKYTYVVACQIYGNQKKGKDPRAEDILSLMKKNEALRVAYVDEVHHEMGGIQYYSVLVKFDQDLQKEVEIYRIRLPG |
| A0A0L9V9W1 | 478-574 | None |
| A0A6A3UIE4 | 170-257 | None |
| A0A287PW09 | 968-1086 | None |
| A0A453Q8N9 | 771-883 | None |
| A0A1D1XCU9 | 208-317 | None |
| A0A835PNY2 | 197-305 | None |
| A0A287RH85 | 98-202 | None |
| A0A2P5DIG4 | 489-574 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.