DPCstruct | MC5981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 391 ± 33 aa |
| Standard deviation of domain lengths | 33.24 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L5M3X6 | 40-440 | MTLGYVSDHWAQYVSHNQGMGLALEPYSMEKLQVEFDELFLRAVLHVLKAKRLGIWLFMSEMPFGTLSVQMLWKLFYLMHQAESGTL… |
| A0A2G5UZW3 | 600-981 | LKHSVRELCSNWRLIRDQIRPGEEQNLQKEVDRIVLLALNYLIHRDSVGLFQFVVALPYGVVSEECRSRCEYALRSNKKMSIHEIYE… |
| A0A2J8MMM6 | 1-350 | None |
| A0A2J8MMK9 | 1-350 | None |
| A0A4W5M3T2 | 1-430 | None |
| A0A1X2G341 | 320-776 | None |
| G0NR04 | 305-664 | None |
| A0A7R9AN56 | 787-1216 | None |
| A0A4Y2DQR5 | 1-356 | None |
| A0A2S2NNB1 | 172-559 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.