DPCstruct | MC59809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 265 ± 52 aa |
| Standard deviation of domain lengths | 52.39 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453ERJ9 | 8-250 | FFKKCLSYVSVQGPCFLQALECLVRLASVRRSLFVEDPARSQFLSHLMSGTREILQTGQGLADHGNYHEFCRLLGRFKVNYQLSELL… |
| A0A3P6PGK9 | 1-204 | MTARVLQNIVQLSSLRRTLFSGLERYEYLDGLVTGVKGIMENPSKLRQQESFHEFCRIIARLKANYQLAELMKVTDYPVLITLLANF… |
| G3HTH4 | 18-219 | None |
| A0A1S3E549 | 10-282 | None |
| A0A183HN43 | 1-164 | None |
| A0A7J5YJF8 | 521-830 | None |
| A0A6V7U815 | 9-193 | None |
| A0A3P6SEY6 | 3-306 | None |
| A0A2K6GH83 | 188-481 | None |
| A0A287F995 | 130-415 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.