DPCstruct | MC59807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 182 |
|---|---|
| Mean domain length (aa) | 162 ± 35 aa |
| Standard deviation of domain lengths | 35.21 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.57 |
| Pfam Score | 94.24 |
| Assigned Pfam label(s) | CL0025- CL0413- PF15091- CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453EQ19 | 6-164 | PIAFRKELDGIIVDVSLQWCSDSYSDTVLGYANSIRTVDGGTHIEGLKTSLTRTINSFAKKSKIMKDKDISLSGEHVREGMTCIISV… |
| A0A3S5DJW0 | 2-113 | TAEKENIVVELSMQWNDSYQETLYCFTNNIPQRDGGTHMAGFRAALTRTLNNYIESEGYAKKAKVSPTGDDAREGLTAILSVKVPDP… |
| A0A7J4EYW2 | 304-475 | None |
| A0A1I8FTX2 | 542-682 | None |
| A0A7I4E7S0 | 3-247 | None |
| A0A855HXD0 | 6-161 | None |
| C0AG68 | 4-162 | None |
| R1BRX6 | 314-488 | None |
| A0A1P8BB88 | 54-237 | None |
| A0A2A2KQS6 | 525-669 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.