DPCstruct | MC59806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 108 ± 9 aa |
| Standard deviation of domain lengths | 8.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 48.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0288 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9G7Y0 | 248-354 | AIEVELCGHATLAAAHTLFSSGLVNSNMIEFVTLSGILTAKKFPETKESDSSDNQNGEVQEGFLIELNFPTVATVDFNSVEVSSISS… |
| A0A251VKV2 | 46-136 | FALCGHATLAASHYIFQAGLVKSKTIEFSSLYGILFAKKVSANDGFYIELDFPVVPVLDFNDLDVSAISEILNGATVVDAVKKNAFE… |
| A0A151SAG2 | 907-1016 | None |
| A0A1R3I5G6 | 66-183 | None |
| A0A830CDZ7 | 75-171 | None |
| A0A2K1IYZ2 | 209-318 | None |
| A0A5A7UU00 | 537-647 | None |
| A0A498IQ84 | 67-171 | None |
| A0A7N2N2M2 | 76-183 | None |
| A0A6A5N726 | 310-412 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.