DPCstruct | MC5980
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 203 ± 20 aa |
| Standard deviation of domain lengths | 19.89 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 67.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8L0A4 | 288-471 | ITSNQEKFFDIFADFDAVPPTLDYTQMLMYFSIDVDPVNGFFRALSVASHTHMPRPQEEELLEQTEDEKLEKRIADPVSEEDEESPN… |
| L5M1Y5 | 12-212 | RLFADPEKEPPLLDYTQMLLYFACHSNAEEGVYRALSVAVGTHIFQPIELVSLTTEKTYFFIDESPLQNYSEPEEAFLSAYRKFIEE… |
| A0A340XKH4 | 464-670 | None |
| A0A834CLN6 | 756-961 | None |
| A0A498P2H4 | 829-989 | None |
| Q8C9J3 | 1518-1724 | None |
| A0A6J3EHQ1 | 98-322 | None |
| A0A151MX22 | 1-230 | None |
| A0A402EBZ7 | 153-355 | None |
| A0A814RBU6 | 195-419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.