DPCstruct | MC59792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 244 ± 28 aa |
| Standard deviation of domain lengths | 27.89 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A392M1N1 | 1-222 | MEKPFPLPRCFGSRDFLEKNPPMVAAVEKSLILDMGPAARQEELTQDLTAMMRVMETVMVLNDEQGSSNREMAKLRTRNEKLEARAL… |
| A0A2Z6PKP1 | 3-180 | DMGPEALKNELADAMVAAFKLMEISSFLNGRECKYLEERDAAREEVVLVNQRLEQTKVNHAAYKEKFKLQVGLVTKLDEKETEAARL… |
| A0A392NFQ0 | 20-263 | None |
| A0A2K3JL32 | 10-229 | None |
| A0A2Z6NXH5 | 143-394 | None |
| A0A2Z6MQF8 | 576-836 | None |
| A0A2Z6MUU5 | 422-688 | None |
| A0A392LXQ3 | 1-249 | None |
| A0A2Z6PS72 | 1-271 | None |
| A0A2Z6PUM6 | 239-509 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.