DPCstruct | MC5979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 236 ± 42 aa |
| Standard deviation of domain lengths | 41.67 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19418 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2KPV2 | 555-788 | QSKGSGTINIETVMKSDKAPKASKGKRSFIVDLRRRNSDKYEWCEIVHDSNCDTRRTFRITIQWLVAIGSKIDQQAQLLHRRCAQYG… |
| L5LZM9 | 8-253 | QRTVTLDVDVNNRTDRLEWCSCYYHGNFSLNAAFEIKLHWMAVTAAVLFEMVQGWHRKATSCGFLLVPVLEGPFALPSYLYGDPLRA… |
| A0A195AUE7 | 302-578 | None |
| A0A7D8Z5H5 | 746-1030 | None |
| A0A3R6W1G2 | 85-327 | None |
| V5BY81 | 381-592 | None |
| A0A1I8IBM3 | 72-251 | None |
| A0A7R9LJL8 | 1-160 | None |
| A0A1V2LHK0 | 687-943 | None |
| A0A0D8XPH6 | 109-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.