DPCstruct | MC59784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 96 ± 16 aa |
| Standard deviation of domain lengths | 15.77 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819G8A7 | 1-94 | MISVLWARIEERLANHETDPLVIALRLLAADAIGMTEKTTPRIAIDLEQLCMLQEADGSWNGGPFLKYGSHNISMSNRGLTTALAVN… |
| A0A0H2R5S0 | 93-183 | KERVVFLFQERVRERFGKEGDALSLAMRILAAASVGIRDVVDRDTLLTMQELDGGFPMGWIYKFANAGIRVGNRGLATALAVKAIKV… |
| A0A0C9WLD0 | 155-275 | None |
| A0A1M2VRR3 | 370-458 | None |
| A0A0U1LMM6 | 130-215 | None |
| A0A135V0Y0 | 167-253 | None |
| A0A4R5BMN0 | 12-99 | None |
| A0A4Y9ZBE8 | 530-661 | None |
| A0A0G2E8R2 | 286-369 | None |
| A0A2C5XT65 | 413-498 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.