DPCstruct | MC59783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 77 ± 17 aa |
| Standard deviation of domain lengths | 16.89 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 74.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 32.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6TN64 | 1-53 | MSKEMPPTDSKPKIRPQQSCLRCRERKVKCDRSRPCHACIIRGIEADCTYLAT |
| A0A017SNT1 | 126-188 | AHTLHQQSASGKPGPTRRARKPRKCLSCEPCRHSKLRCDRQRPCGACQRRDCVSACSFHRFNG |
| A0A178EKG5 | 1-101 | None |
| A0A4Y8DE34 | 2-79 | None |
| A0A7R8AS66 | 1-97 | None |
| L1JPD8 | 25-86 | None |
| A0A1Q3EQG8 | 77-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.