DPCstruct | MC59782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 128 ± 19 aa |
| Standard deviation of domain lengths | 19.18 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0A141 | 122-226 | IEPLPAPVTPSPTPITLAPIPRPPGMTLSQHFFTIATRIDARAMHITSDVEFHLFMDLQAEFGWISFKMTPKQWAAATKTYNNHLEE… |
| F8NWC0 | 1-162 | MFFAPGSKTVAPKCPSDKHTSQNLMAAFSPLADPNLNGLSRFQRIFSILTGIDPRSLTLNSSAKFFLFMDMRLQNKWALFSMTSQKW… |
| A0A1C7M163 | 702-812 | None |
| A0A0D0D2I2 | 1-104 | None |
| A0A401H2N6 | 844-953 | None |
| A0A4Y9ZZ41 | 978-1108 | None |
| A0A5B1QRU7 | 315-436 | None |
| F8NN43 | 263-403 | None |
| F8QJL2 | 194-355 | None |
| A0A401GQN0 | 452-566 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.