DPCstruct | MC5978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 235 ± 34 aa |
| Standard deviation of domain lengths | 33.53 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 65.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01480 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L5LWF7 | 1-287 | MALSKREREELKPWRGKTVKRVLSFSEPTVVTAALNGVGKGVDKEKAADHLKPSLDDSLRFVDKLFEAVGEGRSSRHSKSSSDWSRK… |
| A0A183I9T8 | 4-208 | LNCIEEAVKNVLGSSSHSVVSVLQRGLDKGYSRKKFTDRLFHYVKDEAQIRKLLDLLLEEIKTPVKERRKRSRFEETPAANGIDAKM… |
| L8Y6R2 | 1-193 | None |
| A0A834IPK8 | 1-221 | None |
| A0A2H1VGS7 | 3-282 | None |
| A0A0K8W0X5 | 1-248 | None |
| A0A402FVL0 | 1-207 | None |
| A0A2L2YI52 | 1-209 | None |
| A0A2G8JEP3 | 28-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.