DPCstruct | MC59779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 173 ± 27 aa |
| Standard deviation of domain lengths | 26.93 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C7LQP9 | 1-155 | MSAAAPSTLVHQHITRLPNGDLVLRDRTTSVSHLFTPAQLLLFAAFDRDVRAGTFDPTTAVIPGGYELFQDLWSADADCAYQFAFYD… |
| A0A0C3DLN7 | 1-121 | MAHEPRRNIEKSGPEFYSVRLSLEEGDEGRRMLVHREQVRAYFPFDAALRRGKDCPPYLPCGYTQFCEAYAHEATTLSRFTTFEQDE… |
| A0A0C9WVI4 | 236-393 | None |
| A0A4Q9MFA5 | 3-196 | None |
| A0A0C3C613 | 213-360 | None |
| A0A4Q2CXS4 | 10-185 | None |
| A0A2G8S927 | 2-163 | None |
| A0A0C3KL30 | 2-203 | None |
| A0A2H3JKH0 | 14-179 | None |
| A0A0C3C9U5 | 10-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.