DPCstruct | MC59776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 198 ± 28 aa |
| Standard deviation of domain lengths | 27.70 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445B9N3 | 40-256 | LGYYPINKEQLTKLVIFPEASPSDTYQFFQYGLIDTILIFDNLNIIKKFPTGFIDAVKKFKNMIDTREPRDISLKFTSSQPIFNEEG… |
| A0A2U1MPW0 | 53-234 | IREFQEFPIQVQNIIKTYNALFAHHRPLYFKLHSSYPVFDNNNHKLLVPSITLAELGVSNDVYPPKYEPRDDLPPAIPSSQNLVDAL… |
| A0A2I0HJD9 | 307-545 | None |
| A0A2U1M3H6 | 455-654 | None |
| A0A2U1PM36 | 517-746 | None |
| A0A445BSH7 | 1-169 | None |
| A0A2U1QGC7 | 948-1185 | None |
| A0A445DG81 | 108-331 | None |
| A0A445D4N5 | 1-146 | None |
| A0A3N7H2X8 | 211-437 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.