DPCstruct | MC59774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 180 ± 13 aa |
| Standard deviation of domain lengths | 12.78 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 60.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12134 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1MHH5 | 7-163 | YPNRSLCVLVQVEVALRDLILSDYAKKINVNTSVLAQSEIREIILGAEITPPSQQRQQIAETEKQNLVLAVTTRTTNVHGDDSTTSP… |
| G3IPB5 | 74-264 | RALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIA… |
| A0A804QI56 | 138-304 | None |
| A0A7S0YUK7 | 808-1004 | None |
| M4BI32 | 250-416 | None |
| A0A1I7X4S4 | 596-774 | None |
| A0A3L6F4W2 | 127-305 | None |
| A0A183ERS0 | 1-192 | None |
| C4YMR9 | 319-505 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.