DPCstruct | MC59767
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 90 ± 6 aa |
| Standard deviation of domain lengths | 5.51 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 47.87 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | PF12446- CL0364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9HGS4 | 120-212 | MFRKEYSEVFNGDDDWRAIEVTASATYDWQEDSTYIRHPPFFSTMQEKPEPVQDINNARLLAILADSVTTDHISPAGNIKHDSPAGR… |
| A0A2U1M5T6 | 1-102 | MLQAVQLSFLPDMFKSTYQAITKGNPMWNDLSVEESKLYSWDPKSTYIHEPPYFKNMAMDPPGAHGVKDAYCLLNFGDSITTNHISP… |
| A0A212DK76 | 64-147 | None |
| A0A1W9F5W6 | 131-213 | None |
| A0A6P3ZFX6 | 211-302 | None |
| A0A4Z2E4M6 | 5-91 | None |
| A0A7J4FY82 | 140-231 | None |
| A0A218Y1P9 | 2-79 | None |
| A0A453RDW2 | 375-466 | None |
| A0A540LX58 | 287-375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.