DPCstruct | MC59766
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 191 ± 35 aa |
| Standard deviation of domain lengths | 34.79 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q1MGW5 | 8-177 | HFRGRMREIEKLIRHRHGDIVPGADDALIYVEVIAGLALVEFKEEFVEVVLGWAARWLPWARKADIEDVIYERTKVRFSDLSADALG… |
| A0A515KP03 | 30-217 | GRDGSALPPFDRVYVRLCEIETVLRDHAPFVSDDIISKRVAKVVAHHYRILAAKKYLGITDTLSALAGWCGRWTPNLSMDCVRSIAV… |
| A0A1H4FGJ4 | 240-488 | None |
| A0A6G6YP43 | 33-204 | None |
| A0A6G6Z1D0 | 45-204 | None |
| A0A1E3W726 | 4-162 | None |
| A0A7S7TWQ4 | 51-254 | None |
| A0A1M7UKP0 | 60-242 | None |
| A0A849I5Q5 | 54-254 | None |
| A0A4P7F9D6 | 7-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.