DPCstruct | MC59764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 119 ± 17 aa |
| Standard deviation of domain lengths | 17.22 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 14.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16146 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A356QAV7 | 1-88 | MLIEAFRETADKVNAGLPTMVDEETRLDKATVGPGPRMVYHNTFVGYRSDEIDEDWIKTSLKAHVQGNVCASAGMKPSLQYGAIYTYA |
| A0A515KG83 | 106-225 | RVRNVQSTASSTMATPGIEGEIAGALDKIRSGLPRKIDATTILTGVRNLNAQLIFENIVTTDFSKFDDATKDRLRQSVVRNVCGNAE… |
| A0A382RVQ0 | 25-166 | None |
| A0A1X7ASD7 | 14-148 | None |
| A0A3A8ZW83 | 147-257 | None |
| A0A6G1A2W7 | 244-347 | None |
| A0A4R6TMB3 | 21-127 | None |
| A0A7C3L435 | 358-471 | None |
| A0A7C5QMQ4 | 11-120 | None |
| A0A853NZX4 | 88-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.