DPCstruct | MC5976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 91 ± 10 aa |
| Standard deviation of domain lengths | 9.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 49.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151P1L9 | 121-218 | TLLQQSAMTLPLWIGKPGEKPPPLCGAIPAASDYVAKPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSR… |
| H2Z4H0 | 151-240 | MSMLQKSAQTLPLWIGKPNEKIPPLCGAVCAGPDYIAKPGDKVAARVKTDEPEEQWILAEVVTFNTYLQKYEVDDIDEEGREHHVLS… |
| A0A4Y7M4V0 | 115-207 | None |
| A0A5E4CAW5 | 1-81 | None |
| A0A817NAJ4 | 8-109 | None |
| A0A7R8X5G1 | 99-179 | None |
| A0A1I8GTQ1 | 35-115 | None |
| A0A819ZPL1 | 145-253 | None |
| A0A7R9GF39 | 216-312 | None |
| A0A085MU63 | 421-498 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.