DPCstruct | MC59759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 530 ± 87 aa |
| Standard deviation of domain lengths | 86.64 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.22 |
| Pfam Score | 66.96 |
| Assigned Pfam label(s) | CL0202- CL0059- PF09781 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A085MIP9 | 46-593 | RQLFKLGSLLVFCIIVIIIYEIRLSTFYCPYGEQTVSKGEHRAVVANQTVLFPFRFIACEINGHRKVDCLTNDSMEVFMPFHGFIKN… |
| A0A0J1JBR4 | 1-494 | MYILLLYPSFVCSYEPIVVDVNEGRQIIDGIKKGDEIYFPFSFIKPYYEAYSSEKNGVVYFKHNNAIFRDVAGYTPTGNYLNFDKIA… |
| W6UMI8 | 1-661 | None |
| A0A4E0RUN1 | 1-699 | None |
| A0A7T8K6J3 | 1-407 | None |
| A0A4C1W0N2 | 123-532 | None |
| A0A553PNS9 | 2-594 | None |
| K1QXI7 | 138-642 | None |
| A0A814F6V3 | 5-446 | None |
| A0A7I8WRF7 | 120-675 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.