DPCstruct | MC59750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 112 ± 14 aa |
| Standard deviation of domain lengths | 14.00 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08561 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9DLX3 | 8-119 | FGISRCIQTSAINPAKLSKTASKALKATAVKQPKPVTDAHLLTTRCCGLNKFKEGEDPELKPDSEYPDWLWDIKLGKPEHYTEMDPT… |
| A0A183HXQ6 | 1-79 | GFIDLNTEKLCSHVCVNYLIEGGEDPKILPDSEYPPWLFELKLEGRKELEDLDPEVDGWLYWRAYRLRQLRQIHRIERL |
| A0A672UHW1 | 45-155 | None |
| A0A7J6YM28 | 9-130 | None |
| A0A4W5MYY8 | 13-116 | None |
| A0A0D6R8H9 | 10-120 | None |
| A0A6P5V9J2 | 52-167 | None |
| A8XQ42 | 2-109 | None |
| A0A813SXN3 | 28-137 | None |
| A0A4Y7LN82 | 195-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.